Size:100μl Price:$ 495 Brand:NewEast Place of Origin:USA Immunogen:
Cat.#: 10104 |
Product Name: RhoA Protein |
Synonyms: Ras homolog gene family, member A, ARHA, ARH12, RHO12, RHOH12 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 22 kDa |
Purity: >96% by SDS-PAGE |
Introduction: Small GTPases are a super-family of cellular signaling regulators. RhoA belongs to the Rho sub-family of GTPases. Rho proteins play critical roles in many actin cytoskeleton- dependent processes including platelet aggregation, cell motility, contraction, and cytokinesis. It regulates the formation of stress fibers and focal adhesions in fibroblasts and Ca2+ sensitivity of smooth muscle contraction. |
Amino Acid Sequence (1-193) |
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYD RLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKM KQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged RhoA was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
Select By Alphabet
A B C D E F G H I J K L M N O P Q R S T U V W X Y ZSubscribe to our latest email
(+1) 610-945-2007 [email protected] [email protected] 840 First Avenue, Suite 400, King of Prussia, PA 19406
Copyright © 2010 - 2024 NewEast Biosciences | All rights reserved
Bioactive Transmembrane Proteins Antibodies for Transmembrane Proteins G Protein | GTPase